PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013585128.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 344aa    MW: 39669.5 Da    PI: 7.8001
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013585128.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-1687132147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+ +G+ +W++Ia++++ gR++k+c++rw++ 
   XP_013585128.1  87 RGHWRPAEDVKLKELVAIYGPQNWNLIAEKLQ-GRSGKSCRLRWFNQ 132
                      899*****************************.***********996 PP

2Myb_DNA-binding52.41.2e-16139182146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l +a++++ ++ W+ Iar ++ gRt++++k++w+ 
   XP_013585128.1 139 RRAFTEEEEERLMQAHRLYVNK-WAMIARLFP-GRTDNSVKNHWHV 182
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.75482133IPR017930Myb domain
SMARTSM007173.9E-1486135IPR001005SANT/Myb domain
PfamPF002496.1E-1687132IPR001005SANT/Myb domain
SuperFamilySSF466891.46E-2787180IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.6E-2688140IPR009057Homeodomain-like
CDDcd001672.60E-1290131No hitNo description
PROSITE profilePS5129425.163134188IPR017930Myb domain
SMARTSM007173.2E-13138186IPR001005SANT/Myb domain
PfamPF002492.2E-13139181IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-20141187IPR009057Homeodomain-like
CDDcd001678.87E-11141181No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MDENEIAAAR REASSWNFPF NDINIQLHRR CNTSHEFDIL KSPFGVNEEE SNNHNPNYSN  60
SESGKKETTD SGQSWSSSSS KPSVLGRGHW RPAEDVKLKE LVAIYGPQNW NLIAEKLQGR  120
SGKSCRLRWF NQLDPRINRR AFTEEEEERL MQAHRLYVNK WAMIARLFPG RTDNSVKNHW  180
HVIMARKYRE HSSAYRRRKL IINNPLKPHL PNHPSPNCPS FISTKHYFTR PFHEFNLTHH  240
LVNHASMTTD QNHLVLPFHC FQGYESTEAP MVVGMFGNQM MIEDNVGATS EALYNFPYVD  300
SMSQGKGVPN EAMNLIGMEE VDEEVAKKAK QQPHFFDFLG LGTA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-31851875107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3348160.0AF334816.1 Arabidopsis thaliana putative transcription factor (MYB117) mRNA, complete cds.
GenBankAY5195590.0AY519559.1 Arabidopsis thaliana MYB transcription factor (At1g26780) mRNA, complete cds.
GenBankDQ4462910.0DQ446291.1 Arabidopsis thaliana clone pENTR221-At1g26780 myb family transcription factor (At1g26780) mRNA, complete cds.
GenBankDQ6528620.0DQ652862.1 Arabidopsis thaliana clone 0000017266_0000012084 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013585128.10.0PREDICTED: transcription factor MYB24
TrEMBLA0A0D3CDG10.0A0A0D3CDG1_BRAOL; Uncharacterized protein
STRINGBra016285.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26780.21e-166myb domain protein 117